Neuropeptide Database

Total number of results for Pelophylax ridibundus are 27

NPID	Sequence	Length	Organism	Family	Name	Peptide_REF
NP00777	GSHWAVGHLM	10	Pelophylax ridibundus	Bombesin/neuromedin-B/ranatensin	Neuromedin-C	1859413#Conlon JM, O'Harte F, Vaudry H#Primary structures of the bombesin-like neuropeptides in frog brain show that bombesin is not the amphibian gastrin-releasing peptide#Biochem Biophys Res Commun 1991 Jul 31;178(2):526-30
NP00818	ACNTATCVTHRLADFLSRSGGMAKNNFVPTNVGSAF	36	Pelophylax ridibundus	Calcitonin	Calcitonin gene-related peptide	8332553#Conlon JM, Tonon MC, Vaudry H#Isolation and structural characterization of calcitonin gene-related peptide from the brain and intestine of the frog, Rana ridibunda#Peptides 1993 May-Jun;14(3):581-6
NP00952	QYYQVPQQDQEYRMKTLQRLPSPDMLKALEYIENLRKQASRTESLPDYTSYQGAPFLSEQKDTQALSTDTAKSPTSDDESEWMRAMLEALMQAEKEAKVSPQEKNNLYMDKNIPPELIEDYDSNKWSEKRPKAGKFSSRLYDDYSRDNPLKRTNEIVEGQYTPQSLATLQSVFQELGKLKGQANNKRDRMEEDQKLYKDDEDDLYKANNIAYEDVAGGEDWNPIEEKVESQTQEELKESKEEVEKTDDMEDEIKRSGLLGLQDEEPEKDTKEQESENLSNLMNTYLNMWMNRMDKGKQNPDRRSLRFSGKELDPEAIYQLIDISRNLQIPPEDLIDMLRDEDGRKFGGRLESEKEVDVPLDLDEVTETMTDKTNVYKNKQGFVRQPTSPVLPNIPEGLTVEDMVNLMGADKLQNRFKQNNGLQRPYPMLSKIKGHKAIWPKESEKRQIEYESRPEKEEELADYVVKMLAKYPELLGNNQNKKMPIPYSAGDLQELEKQYENALRGYVNMRGYQDLETVSSSNRRLSTRENDDTQNKQYIDEDLLMKVLEYLNQEKAEKARDHSVKRSMENM	571	Pelophylax ridibundus	Chromogranin/secretogranin	Secretogranin-2
NP00953	TNEIVEGQYTPQSLATLQSVFQELGKLKGQANN	33	Pelophylax ridibundus	Chromogranin/secretogranin	Secretoneurin	2060624#Vaudry H., Conlon J.M.#Identification of a peptide arising from the specific post- translation processing of secretogranin II.# FEBS Lett. 284:31-33(1991).
NP02031	GWTLNSAGYLLGPHAIDNHRSFNDKHGLA	29	Pelophylax ridibundus	Galanin	Galanin	7540547#Chartrel N., Wang Y., Fournier A., Vaudry H., Conlon J.M.;#Frog vasoactive intestinal polypeptide and galanin: primary structures and effects on pituitary adenylate cyclase.;#Endocrinology 136:3079-3086(1995).
NP02407	HADDLLNKAYRNLLGQLSARKYLHTLMAKHLGAVSSSLEDDSEPLS	46	Pelophylax ridibundus	Glucagon	Growth hormone-releasing factor
NP02408	HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRIKNK	38	Pelophylax ridibundus	Glucagon	Pituitary adenylate cyclase-activating polypeptide 38	1720095#Chartrel N., Tonon M.-C., Vaudry H., Conlon J.M.#Primary structure of frog pituitary adenylate cyclase-activating polypeptide (PACAP) and effects of ovine PACAP on frog pituitary.# Endocrinology 129:3367-3371(1991).
NP02409	HSDGIFTDSYSRYRKQMAVKKYLAAVL	27	Pelophylax ridibundus	Glucagon	Pituitary adenylate cyclase-activating polypeptide 27	1720095#Chartrel N., Tonon M.-C., Vaudry H., Conlon J.M.#Primary structure of frog pituitary adenylate cyclase-activating polypeptide (PACAP) and effects of ovine PACAP on frog pituitary.# Endocrinology 129:3367-3371(1991).
NP02410	HSDAVFTDNYSRFRKQMAVKKYLNSVLT	28	Pelophylax ridibundus	Glucagon	Vasoactive intestinal peptide	7540547#Chartrel N., Wang Y., Fournier A., Vaudry H., Conlon J.M.#Frog vasoactive intestinal polypeptide and galanin: primary structures and effects on pituitary adenylate cyclase.# Endocrinology 136:3079-3086(1995).
NP03763	EAHISKARRPYIL	13	Pelophylax ridibundus	Neurotensin	Neurotensin	9751493#Desrues L, Tonon MC, Leprince J, Vaudry H, Conlon JM#Isolation, primary structure, and effects on alpha-melanocyte-stimulating hormone release of frog neurotensin#Endocrinology 1998 Oct;139(10):4140-6
NP03909	YPSKPDNPGEDAPAEDMAKYYSALRHYINLITRQRY	36	Pelophylax ridibundus	NPY	Melanostatin	1673794#Chartrel N., Conlon J.M., Danger J.-M., Fournier A., Tonon M.-C., Vaudry H.; #Characterization of melanotropin-release-inhibiting factor (melanostatin) from frog brain: homology with human neuropeptide Y.; #Proc. Natl. Acad. Sci. U.S.A. 88:3862-3866(1991).
NP03931	YPPKPENPGEDASPEEMTKYLTALRHYINLVTRQRY	36	Pelophylax ridibundus	NPY	Pancreatic polypeptide	1620652#Conlon JM, Chartrel N, Vaudry H#Primary structure of frog PYY: implications for the molecular evolution of the pancreatic polypeptide family#Peptides 1992 Jan-Feb;13(1):145-9
NP04055	KYVMSHFRWNKF	12	Pelophylax ridibundus	Opioid	Lys-gamma 1-MSH	1331655#Bunel DT, Conlon JM, Chartrel N, Tonon MC, Vaudry H#Isolation and structural characterization of peptides related to alpha- and gamma-melanocyte-stimulating hormone (MSH) from the frog brain#Brain Res Mol Brain Res 1992 Sep;15(1-2):1-7
NP04838	QCWESNKCTDLSSEDGILECIKACKMDLSAESPVFPGNGHMQPLSENIRKYVMSHFRWNKFGRRNSTSNDNNNGGY	76	Pelophylax ridibundus	POMC	NPP (By similarity)
NP04839	YVMSHFRWNKF	11	Pelophylax ridibundus	POMC	Melanotropin gamma (By similarity)
NP04840	SYSMEHFRWGKPVGKKRRPIKVFPTDAEEESSEIFPLEL	39	Pelophylax ridibundus	POMC	Corticotropin (By similarity)
NP04841	SYSMEHFRWGKPV	13	Pelophylax ridibundus	POMC	Melanotropin alpha (By similarity)
NP04842	PIKVFPTDAEEESSEIFPLEL	21	Pelophylax ridibundus	POMC	Corticotropin-like intermediary peptide (By similarity)
NP04843	ELSLEFDYPDTNSEEDLDDGELLDGPVKKDRKYKMHHFRWEGPPKDKRYGGFMTPERSQTPLMTLFKNAIIKNAHKKGQ	79	Pelophylax ridibundus	POMC	Lipotropin beta (By similarity)
NP04844	ELSLEFDYPDTNSEEDLDDGELLDGPVKKDRKYKMHHFRWEGPPKD	46	Pelophylax ridibundus	POMC	Lipotropin gamma (By similarity)
NP04845	DRKYKMHHFRWEGPPKD	17	Pelophylax ridibundus	POMC	Melanotropin beta (By similarity)
NP04846	YGGFMTPERSQTPLMTLFKNAIIKNAHKKGQ	31	Pelophylax ridibundus	POMC	Beta-endorphin (By similarity)
NP04847	YGGFM	5	Pelophylax ridibundus	POMC	Met-enkephalin (By similarity)
NP05397	AGCKNFFWKTFTSC	14	Pelophylax ridibundus	Somastostatin	Somatostatin-14	1358069#Vaudry H., Chartrel N., Conlon J.M.#Isolation of [Pro2,Met13]somatostatin-14 and somatostatin-14 from the frog brain reveals the existence of a somatostatin gene family in a tetrapod.# Biochem. Biophys. Res. Commun. 188:477-482(1992).
NP05728	KPNPERFYGLM	11	Pelophylax ridibundus	Tachykinin	Ranakinin	1658233#O'Harte F., Burcher E., Lovas S., Smith D.D., Vaudry H., Conlon J.M.; #Ranakinin: a novel NK1 tachykinin receptor agonist isolated with neurokinin B from the brain of the frog Rana ridibunda.; #J. Neurochem. 57:2086-2091(1991).
NP05729	HKLDSFIGLM	10	Pelophylax ridibundus	Tachykinin	Neurokinin A	1332683#Wang Y., Badgery-Parker T., Lovas S., Chartrel N., Vaudry H., Burcher E., Conlon J.M.; #Primary structure and receptor-binding properties of a neurokinin A- related peptide from frog gut.; #Biochem. J. 287:827-832(1992).
NP05730	DMHDFFVGLM	10	Pelophylax ridibundus	Tachykinin	Neurokinin-B	1658233#O'Harte F., Burcher E., Lovas S., Smith D.D., Vaudry H., Conlon J.M.; #Ranakinin: a novel NK1 tachykinin receptor agonist isolated with neurokinin B from the brain of the frog Rana ridibunda.; #J. Neurochem. 57:2086-2091(1991).